Y

YouLibs

Remove Touch Overlay

Drawing YOUR CHARACTERS as Chibis! || OCs #16

Duration: 13:05Views: 18.4KLikes: 1.2KDate Created: Feb, 2022

Channel: appleminte

Category: Film & Animation

Tags: artistchibiwashitapepaintartsuppliesapplemiinteprismacolorsketchbookapplepastelmermaiddiydesigndrawingapplemintevolcanoart.designdrawing your ocsdrawartworkcreativepaintingmarkercopicillustrationsketchhowtodrawanime

Description: Thanks to .design for sponsoring this video! Get your .design domain by clicking this link! thld.co/appleminte_0222_design ☆ ONLINE SHOP: appleminte.com​​​​​​​​​ ☆ PIN CLUB: patreon.com/appleminte​​​​​​​​​ ☆ ☆ Join my Discord (13+): discord.gg/cFN6gzqzNa ☆ INSTAGRAM: instagram.com/applemiinte... ☆ SHOP INSTA: instagram.com/applemintes...... ---------------------------------------------------------------------------- SUPPLIES I USE: ☆ Marker Storage: amzn.to/2vE4uWW​​​​​​​​​ ☆ Pastel POSCA Pens: amzn.to/2xhJvtA​​​​​​​​​ ☆ POSCA Pens: amzn.to/2uL8Ta7​​​​​​​​​ ☆ Bianyo 72 Set Brush Markers: amzn.to/3gTkppA​ ☆ Ohuhu Brush Markers: amzn.to/33R16E3​​​​​​​​​ ☆ Copic Markers (72-A): goo.gl/QK1Qss​​​​​​​​​ ☆ Canson XL 7x10 Pad: goo.gl/Jvi9nd​​​​​​​​​ ☆ All Arteza Products: goo.gl/Tr3dJB​​​​​​​​​ If you like this video, please check out the other videos on my channel and subscribe! :) ---------------------------------------------------------------------------- All music is copyright-free! Disclaimer: The product links above are affiliate links, and I earn a small commission if you use them. :)

Swipe Gestures On Overlay