
Channel: appleminte
Category: Film & Animation
Tags: artistchibiwashitapepaintartsuppliesapplemiinteprismacolorsketchbookapplepastelmermaiddiydesigndrawingapplemintevolcanoart.designdrawing your ocsdrawartworkcreativepaintingmarkercopicillustrationsketchhowtodrawanime
Description: Thanks to .design for sponsoring this video! Get your .design domain by clicking this link! thld.co/appleminte_0222_design ☆ ONLINE SHOP: appleminte.com ☆ PIN CLUB: patreon.com/appleminte ☆ ☆ Join my Discord (13+): discord.gg/cFN6gzqzNa ☆ INSTAGRAM: instagram.com/applemiinte... ☆ SHOP INSTA: instagram.com/applemintes...... ---------------------------------------------------------------------------- SUPPLIES I USE: ☆ Marker Storage: amzn.to/2vE4uWW ☆ Pastel POSCA Pens: amzn.to/2xhJvtA ☆ POSCA Pens: amzn.to/2uL8Ta7 ☆ Bianyo 72 Set Brush Markers: amzn.to/3gTkppA ☆ Ohuhu Brush Markers: amzn.to/33R16E3 ☆ Copic Markers (72-A): goo.gl/QK1Qss ☆ Canson XL 7x10 Pad: goo.gl/Jvi9nd ☆ All Arteza Products: goo.gl/Tr3dJB If you like this video, please check out the other videos on my channel and subscribe! :) ---------------------------------------------------------------------------- All music is copyright-free! Disclaimer: The product links above are affiliate links, and I earn a small commission if you use them. :)















![video thumbnail for: Speed Drawing - Naruto VS Gaara (Naruto Shippuden) [HD]](https://i.ytimg.com/vi/RQGLL682ZI8/mqdefault.jpg)



